PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_010072-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 300aa    MW: 34496 Da    PI: 8.2219
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_010072-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.74.7e-124086248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g+W+  Ede+l  +v ++G + W+ + ++  + R++k+c++rw+++l
  AHYPO_010072-RA 40 GPWSSAEDEQLNAYVSEFGAKKWEDVKKRTRLLRSGKSCRLRWLNHL 86
                     79*****************************99************97 PP

2Myb_DNA-binding41.14.2e-1392135146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+ T eE   +++++ + G+  W++Ia++++ gRt++++k++w++
  AHYPO_010072-RA  92 KGPLTREEKNCIIKLHYKSGNQ-WSLIASKLP-GRTDNEVKNFWNT 135
                      6889****************99.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.4813486IPR017930Myb domain
SuperFamilySSF466892.29E-2538133IPR009057Homeodomain-like
SMARTSM007176.3E-93888IPR001005SANT/Myb domain
PfamPF002491.2E-104086IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-194093IPR009057Homeodomain-like
CDDcd001672.99E-74186No hitNo description
PROSITE profilePS5129421.36287141IPR017930Myb domain
SMARTSM007172.1E-1391139IPR001005SANT/Myb domain
PfamPF002497.8E-1292135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-2294139IPR009057Homeodomain-like
CDDcd001671.08E-896137No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MDMISHTKKR KIAECQEKSP GVKEVLSDEK SSKGILLKIG PWSSAEDEQL NAYVSEFGAK  60
KWEDVKKRTR LLRSGKSCRL RWLNHLRPEL KKGPLTREEK NCIIKLHYKS GNQWSLIASK  120
LPGRTDNEVK NFWNTRLKKC QHTGEPIYPT DTCSPIENEI RQSNEMMSNQ NGDNYQSDVL  180
QTNANIMIPH VEFKRLWSNQ EINSYLSRIC RADNISSTTK KISEDILRTL NNDIAQQDYN  240
VMNFHTPVSK DHNVMNAHIH VQELLSIQHK CDTAIQFSSP SHEDVDAFFQ FSSFDGCEP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-263713925126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010673832.11e-56PREDICTED: transcription factor GAMYB-like
RefseqXP_010673831.11e-56PREDICTED: transcription factor GAMYB-like
RefseqXP_010673830.11e-56PREDICTED: transcription factor GAMYB-like
TrEMBLA0A0K9R2L52e-58A0A0K9R2L5_SPIOL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26930.19e-49myb domain protein 97